![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) |
![]() | Protein Nucleoside diphosphate kinases [54921] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54922] (2 PDB entries) |
![]() | Domain d1nuee_: 1nue E: [39080] |
PDB Entry: 1nue (more details), 2 Å
SCOP Domain Sequences for d1nuee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nuee_ d.58.6.1 (E:) Nucleoside diphosphate kinases {Human (Homo sapiens)} anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd svksaekeislwfkpeelvdykscahdwvye
Timeline for d1nuee_: