Lineage for d1nuee_ (1nue E:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32559Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 32560Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 32561Protein Nucleoside diphosphate kinases [54921] (6 species)
  7. 32616Species Human (Homo sapiens) [TaxId:9606] [54922] (2 PDB entries)
  8. 32621Domain d1nuee_: 1nue E: [39080]

Details for d1nuee_

PDB Entry: 1nue (more details), 2 Å

PDB Description: x-ray structure of nm23 human nucleoside diphosphate kinase b complexed with gdp at 2 angstroms resolution

SCOP Domain Sequences for d1nuee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuee_ d.58.6.1 (E:) Nucleoside diphosphate kinases {Human (Homo sapiens)}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

SCOP Domain Coordinates for d1nuee_:

Click to download the PDB-style file with coordinates for d1nuee_.
(The format of our PDB-style files is described here.)

Timeline for d1nuee_: