Lineage for d1nueb_ (1nue B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) 
Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) Protein Nucleoside diphosphate kinases [54921] (6 species) 
Species Human (Homo sapiens) [TaxId:9606] [54922] (2 PDB entries) 
Domain d1nueb_: 1nue B: [39077]
Details for d1nueb_
PDB Entry: 1nue (more details), 2 Å
PDB Description: x-ray structure of nm23 human nucleoside diphosphate kinase b complexed with gdp at 2 angstroms resolution
SCOP Domain Sequences for d1nueb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nueb_ d.58.6.1 (B:) Nucleoside diphosphate kinases {Human (Homo sapiens)}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye
SCOP Domain Coordinates for d1nueb_:
Click to download the PDB-style file with coordinates for d1nueb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nueb_:
- d1nueb_ appears in SCOP 1.57
- d1nueb_ appears in the current release, SCOPe 2.08
View in 3D
