SCOPe 2.08: Domain d1nueb_: 1nue B:

Lineage for d1nueb_ (1nue B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)

8. Domain d1nueb_: 1nue B: [39077]
   complexed with gdp, mg

Details for d1nueb_

PDB Entry: 1nue, 2 Å

PDB Description: x-ray structure of nm23 human nucleoside diphosphate kinase b complexed with gdp at 2 angstroms resolution

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d1nueb_:

Sequence; same for both SEQRES and ATOM records:

>d1nueb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

Timeline for d1nueb_:

• d1nueb_ first appeared (with stable ids) in SCOP 1.55
  
• d1nueb_ appears in SCOPe 2.07