Lineage for d1nuea_ (1nue A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80202Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 80203Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 80204Protein Nucleoside diphosphate kinases [54921] (6 species)
  7. 80263Species Human (Homo sapiens) [TaxId:9606] [54922] (2 PDB entries)
  8. 80264Domain d1nuea_: 1nue A: [39076]

Details for d1nuea_

PDB Entry: 1nue (more details), 2 Å

PDB Description: x-ray structure of nm23 human nucleoside diphosphate kinase b complexed with gdp at 2 angstroms resolution

SCOP Domain Sequences for d1nuea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuea_ d.58.6.1 (A:) Nucleoside diphosphate kinases {Human (Homo sapiens)}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

SCOP Domain Coordinates for d1nuea_:

Click to download the PDB-style file with coordinates for d1nuea_.
(The format of our PDB-style files is described here.)

Timeline for d1nuea_: