Lineage for d6l3xg_ (6l3x G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852296Protein Clp protease, ClpP subunit [52098] (11 species)
  7. 2852565Species Staphylococcus aureus [TaxId:273036] [388880] (3 PDB entries)
  8. 2852586Domain d6l3xg_: 6l3x G: [390755]
    automated match to d4mxia_
    complexed with e4u

Details for d6l3xg_

PDB Entry: 6l3x (more details), 2.31 Å

PDB Description: discovery of novel peptidomimetic boronate clpp inhibitors with noncanonical enzyme mechanism as potent virulence blockers in vitro and in vivo
PDB Compounds: (G:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6l3xg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l3xg_ c.14.1.1 (G:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 273036]}
diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy
dtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqateiei
aanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpetk

SCOPe Domain Coordinates for d6l3xg_:

Click to download the PDB-style file with coordinates for d6l3xg_.
(The format of our PDB-style files is described here.)

Timeline for d6l3xg_: