Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (11 species) |
Species Staphylococcus aureus [TaxId:273036] [388880] (3 PDB entries) |
Domain d6l3xg_: 6l3x G: [390755] automated match to d4mxia_ complexed with e4u |
PDB Entry: 6l3x (more details), 2.31 Å
SCOPe Domain Sequences for d6l3xg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l3xg_ c.14.1.1 (G:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 273036]} diysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvtagfaiy dtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqateiei aanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpetk
Timeline for d6l3xg_: