Lineage for d6ky2a2 (6ky2 A:96-357)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974891Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2974955Protein automated matches [226885] (7 species)
    not a true protein
  7. 2974959Species Daphnia magna [TaxId:35525] [390671] (2 PDB entries)
  8. 2974961Domain d6ky2a2: 6ky2 A:96-357 [390752]
    Other proteins in same PDB: d6ky2a1, d6ky2a3
    automated match to d5u92a2
    complexed with po4

Details for d6ky2a2

PDB Entry: 6ky2 (more details), 1.87 Å

PDB Description: crystal structure of arginine kinase wild type from daphnia magna
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d6ky2a2:

Sequence, based on SEQRES records: (download)

>d6ky2a2 d.128.1.2 (A:96-357) automated matches {Daphnia magna [TaxId: 35525]}
gdahpprdfgdletfgnldpegafivstrvrcgrslagyafnpclteanykemeekvvas
lsslegelkgtyypltgmtkevqtqliqdrflfkegdrflqaanacrywptgrgiyhnda
ktflvwcneedhlriismqkggdlkavyarlvnaineiekripfshhdkygfltfcptnl
gttirasvhialpklaadlakleeaagkfnlqvrgtagehteaeggvydisnkrrmglte
yqavkemydglqelirmekeaa

Sequence, based on observed residues (ATOM records): (download)

>d6ky2a2 d.128.1.2 (A:96-357) automated matches {Daphnia magna [TaxId: 35525]}
gdahpprdfgdletfgnldpegafivstrvrcgrslagyafnpclteanykemeekvvas
lsslegelkgtyypltgmtkevqtqliqdrflfkegdrflqaanacrywptgrgiyhnda
ktflvwcneedhlriismqkggdlkavyarlvnaineiekripfshhdkygfltfcptnl
gttirasvhialpklaadlaklaagkfnlqvrgtagehteaeggvydisnkrrmglteyq
avkemydglqelirmekeaa

SCOPe Domain Coordinates for d6ky2a2:

Click to download the PDB-style file with coordinates for d6ky2a2.
(The format of our PDB-style files is described here.)

Timeline for d6ky2a2: