Lineage for d6ky2a1 (6ky2 A:1-95)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332344Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2332345Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2332410Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 2332411Protein automated matches [226884] (9 species)
    not a true protein
  7. 2332415Species Daphnia magna [TaxId:35525] [390669] (2 PDB entries)
  8. 2332417Domain d6ky2a1: 6ky2 A:1-95 [390751]
    Other proteins in same PDB: d6ky2a2, d6ky2a3
    automated match to d5u92a1
    complexed with po4

Details for d6ky2a1

PDB Entry: 6ky2 (more details), 1.87 Å

PDB Description: crystal structure of arginine kinase wild type from daphnia magna
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d6ky2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ky2a1 a.83.1.0 (A:1-95) automated matches {Daphnia magna [TaxId: 35525]}
mvdaavaekleagfqklqeatncksllkkhltreifdkikdlktsfgstlldviqsgven
ldsgfgvyapdaeaysvfndlfepmicdyhtgfkp

SCOPe Domain Coordinates for d6ky2a1:

Click to download the PDB-style file with coordinates for d6ky2a1.
(The format of our PDB-style files is described here.)

Timeline for d6ky2a1: