Lineage for d2gnka_ (2gnk A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603695Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 603696Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins)
  6. 603733Protein PII-homolog GlnK [54917] (1 species)
  7. 603734Species Escherichia coli [TaxId:562] [54918] (2 PDB entries)
  8. 603737Domain d2gnka_: 2gnk A: [39075]
    complexed with atp

Details for d2gnka_

PDB Entry: 2gnk (more details), 2 Å

PDB Description: glnk, a signal protein from e. coli

SCOP Domain Sequences for d2gnka_:

Sequence, based on SEQRES records: (download)

>d2gnka_ d.58.5.1 (A:) PII-homolog GlnK {Escherichia coli}
mklvtviikpfkledvrealssigiqgltvtevkgfgrqkgnaelyrgaeysvnflpkvk
idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal

Sequence, based on observed residues (ATOM records): (download)

>d2gnka_ d.58.5.1 (A:) PII-homolog GlnK {Escherichia coli}
mklvtviikpfkledvrealssigiqgltvtevkgfgrlpkvkidvaiaddqldevidiv
skaaytgkigdgkifvaelqrvirirtgeadeaal

SCOP Domain Coordinates for d2gnka_:

Click to download the PDB-style file with coordinates for d2gnka_.
(The format of our PDB-style files is described here.)

Timeline for d2gnka_: