SCOP 1.71: Domain d1gnkb_: 1gnk B:

Lineage for d1gnkb_ (1gnk B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins)

6. Protein PII-homolog GlnK [54917] (1 species)

7. Species Escherichia coli [TaxId:562] [54918] (2 PDB entries)

8. Domain d1gnkb_: 1gnk B: [39074]
   complexed with so4

Details for d1gnkb_

PDB Entry: 1gnk, 2 Å

PDB Description: glnk, a signal protein from e. coli

SCOP Domain Sequences for d1gnkb_:

Sequence; same for both SEQRES and ATOM records:

>d1gnkb_ d.58.5.1 (B:) PII-homolog GlnK {Escherichia coli}
mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk
idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal

Timeline for d1gnkb_:

• d1gnkb_ first appeared (with stable ids) in SCOP 1.55
  
• d1gnkb_ appears in SCOP 1.69
  
• d1gnkb_ appears in SCOP 1.73
  
• d1gnkb_ appears in the current release, SCOPe 2.08