Lineage for d1gnkb_ (1gnk B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517841Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2517842Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 protein domains)
  6. 2517905Protein PII-homolog GlnK [54917] (2 species)
  7. 2517906Species Escherichia coli [TaxId:562] [54918] (3 PDB entries)
  8. 2517908Domain d1gnkb_: 1gnk B: [39074]
    complexed with so4

Details for d1gnkb_

PDB Entry: 1gnk (more details), 2 Å

PDB Description: glnk, a signal protein from e. coli
PDB Compounds: (B:) protein (glnk)

SCOPe Domain Sequences for d1gnkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnkb_ d.58.5.1 (B:) PII-homolog GlnK {Escherichia coli [TaxId: 562]}
mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk
idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal

SCOPe Domain Coordinates for d1gnkb_:

Click to download the PDB-style file with coordinates for d1gnkb_.
(The format of our PDB-style files is described here.)

Timeline for d1gnkb_: