Lineage for d6kyjg1 (6kyj G:13-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952778Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 2952779Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (13 species)
  7. 2952876Species Rice (Oryza sativa) [TaxId:4530] [117976] (5 PDB entries)
    Uniprot P12089
  8. 2952892Domain d6kyjg1: 6kyj G:13-150 [390733]
    Other proteins in same PDB: d6kyja2, d6kyjc2, d6kyje2, d6kyjg2, d6kyjs_, d6kyju_, d6kyjw_, d6kyjy_
    automated match to d1wdde2
    complexed with gol, so4

Details for d6kyjg1

PDB Entry: 6kyj (more details), 1.7 Å

PDB Description: hybrid-rubisco (rice rbcl and sorghum rbcs) in complex with sulfate ions
PDB Compounds: (G:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6kyjg1:

Sequence, based on SEQRES records: (download)

>d6kyjg1 d.58.9.1 (G:13-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
fkagvkdykltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtd
gltsldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalra
lrledlripptysktfqg

Sequence, based on observed residues (ATOM records): (download)

>d6kyjg1 d.58.9.1 (G:13-150) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]}
fkagvltyytpeyetkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwtdglts
ldrykgrcyhiepvvgednqyiayvaypldlfeegsvtnmftsivgnvfgfkalralrle
dlripptysktfqg

SCOPe Domain Coordinates for d6kyjg1:

Click to download the PDB-style file with coordinates for d6kyjg1.
(The format of our PDB-style files is described here.)

Timeline for d6kyjg1: