SCOPe 2.08: Domain d6l0ua_: 6l0u A:

Lineage for d6l0ua_ (6l0u A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold

6. Protein automated matches [190953] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188562] (7 PDB entries)

8. Domain d6l0ua_: 6l0u A: [390726]
   automated match to d4kyka_
   complexed with e1l, zn

Details for d6l0ua_

PDB Entry: 6l0u, 1.95 Å

PDB Description: crystal structure of mouse glyoxalase i complexed with a small molecule inhibitor

PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d6l0ua_:

Sequence; same for both SEQRES and ATOM records:

>d6l0ua_ d.32.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
passgltdetafsccsdpdpstkdfllqqtmlrikdpkksldfytrvlgltllqkldfpa
mkfslyflayedkndipkdksektawtfsrkatlelthnwgteddetqsyhngnsdprgf
ghigiavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkiatii

Timeline for d6l0ua_:

• d6l0ua_ first appeared in SCOPe 2.07