SCOP 1.75: Domain d1pila_: 1pil A:

Lineage for d1pila_ (1pil A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (5 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (3 proteins)

6. Protein PII (product of glnB) [54915] (5 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Escherichia coli [TaxId:562] [54916] (2 PDB entries)

8. Domain d1pila_: 1pil A: [39072]

Details for d1pila_

PDB Entry: 1pil, 2.7 Å

PDB Description: structure of the escherichia coli signal transducing protein pii

PDB Compounds: (A:) signal transducing protein p2

SCOP Domain Sequences for d1pila_:

Sequence; same for both SEQRES and ATOM records:

>d1pila_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 562]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai

Timeline for d1pila_:

• d1pila_ first appeared (with stable ids) in SCOP 1.55, called d1pil__
  
• d1pila_ appears in SCOP 1.73
  
• d1pila_ appears in SCOPe 2.01
  
• d1pila_ appears in the current release, SCOPe 2.08