Lineage for d1pil__ (1pil -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.5: Prokaryotic signal transducing protein [54913] (1 family) 
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (2 proteins) Protein PII (product of glnB) [54915] (1 species) Species Escherichia coli [TaxId:562] [54916] (2 PDB entries) 
Domain d1pil__: 1pil - [39072]
Details for d1pil__
PDB Entry: 1pil (more details), 2.7 Å
PDB Description: structure of the escherichia coli signal transducing protein pii
SCOP Domain Sequences for d1pil__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pil__ d.58.5.1 (-) PII (product of glnB) {Escherichia coli}
mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai
SCOP Domain Coordinates for d1pil__:
Click to download the PDB-style file with coordinates for d1pil__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pil__:
- d1pil__ appears in SCOP 1.57
- d1pil__ appears in the current release, SCOPe 2.08, called d1pila_
View in 3D