SCOP 1.75: Domain d2piia_: 2pii A:

Lineage for d2piia_ (2pii A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (5 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (3 proteins)

6. Protein PII (product of glnB) [54915] (5 species)
   trimer with orthogonal packing of beta-sheets around the threefold axis

7. Species Escherichia coli [TaxId:562] [54916] (2 PDB entries)

8. Domain d2piia_: 2pii A: [39071]

Details for d2piia_

PDB Entry: 2pii, 1.9 Å

PDB Description: pii, glnb product

PDB Compounds: (A:) pii

SCOP Domain Sequences for d2piia_:

Sequence; same for both SEQRES and ATOM records:

>d2piia_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 562]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai

Timeline for d2piia_:

• d2piia_ first appeared (with stable ids) in SCOP 1.55, called d2pii__
  
• d2piia_ appears in SCOP 1.73
  
• d2piia_ appears in SCOPe 2.01
  
• d2piia_ appears in the current release, SCOPe 2.08