SCOPe 2.01: Domain d1scjb_: 1scj B:

Lineage for d1scjb_ (1scj B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families)

5. Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
   decorated with additional structure

6. Protein Subtilisin prosegment [54906] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [54908] (1 PDB entry)

8. Domain d1scjb_: 1scj B: [39069]
   Other proteins in same PDB: d1scja_
   complexed with ca

Details for d1scjb_

PDB Entry: 1scj, 2 Å

PDB Description: crystal structure of subtilisin-propeptide complex

PDB Compounds: (B:) subtilisin e

SCOPe Domain Sequences for d1scjb_:

Sequence; same for both SEQRES and ATOM records:

>d1scjb_ d.58.3.2 (B:) Subtilisin prosegment {Bacillus subtilis [TaxId: 1423]}
ekkyivgfkqtmsamssakkkdvisqkggkvekqfkyvnaaaatldekavkelkkdpsva
yveedhiahey

Timeline for d1scjb_:

• d1scjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1scjb_ appears in SCOP 1.75
  
• d1scjb_ appears in SCOPe 2.02
  
• d1scjb_ appears in the current release, SCOPe 2.08