Lineage for d1scjb_ (1scj B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517095Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 2517116Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 protein domains)
    decorated with additional structure
  6. 2517124Protein Subtilisin prosegment [54906] (2 species)
  7. 2517127Species Bacillus subtilis [TaxId:1423] [54908] (1 PDB entry)
  8. 2517128Domain d1scjb_: 1scj B: [39069]
    Other proteins in same PDB: d1scja_
    complexed with ca

Details for d1scjb_

PDB Entry: 1scj (more details), 2 Å

PDB Description: crystal structure of subtilisin-propeptide complex
PDB Compounds: (B:) subtilisin e

SCOPe Domain Sequences for d1scjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scjb_ d.58.3.2 (B:) Subtilisin prosegment {Bacillus subtilis [TaxId: 1423]}
ekkyivgfkqtmsamssakkkdvisqkggkvekqfkyvnaaaatldekavkelkkdpsva
yveedhiahey

SCOPe Domain Coordinates for d1scjb_:

Click to download the PDB-style file with coordinates for d1scjb_.
(The format of our PDB-style files is described here.)

Timeline for d1scjb_: