Lineage for d6l0pa_ (6l0p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907502Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 2907503Species Aeropyrum pernix [TaxId:56636] [142742] (7 PDB entries)
    Uniprot Q9YBL2 1-382
  8. 2907514Domain d6l0pa_: 6l0p A: [390681]
    automated match to d1wkvb_
    complexed with e1u, mpd

Details for d6l0pa_

PDB Entry: 6l0p (more details), 1.79 Å

PDB Description: crystal structure of the o-phosphoserine sulfhydrylase from aeropyrum pernix complexed with o-phosphoserine
PDB Compounds: (A:) Protein CysO

SCOPe Domain Sequences for d6l0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l0pa_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Aeropyrum pernix [TaxId: 56636]}
aladisgyldvldsvrgfsylenarevlrsgearclgnprsepeyvkalyvigasripvg
dgcshtleelgvfdisvpgemvfpspldffergkptplvrsrlqlpngvrvwlklewynp
fslsvadrpaveiisrlsrrvekgslvadatssnfgvalsavarlygyrarvylpgaaee
fgkllprllgaqvivdpeapstvhllprvmkdsknegfvhvnqyyndanfeahmrgtare
ifvqsrrgglalrgvagslgtsghmsaaafylqsvdpsiravlvqpaqgdsipgiarvet
gmlwinmldisytlaevtleeameavvevarsdglvigpsggaavkalakkaaegdlepg
dyvvvvpdtgfkylslvqnale

SCOPe Domain Coordinates for d6l0pa_:

Click to download the PDB-style file with coordinates for d6l0pa_.
(The format of our PDB-style files is described here.)

Timeline for d6l0pa_: