Lineage for d1spbp_ (1spb P:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906795Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 1906816Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
    decorated with additional structure
  6. 1906824Protein Subtilisin prosegment [54906] (2 species)
  7. 1906825Species Bacillus amyloliquefaciens [TaxId:1390] [54907] (1 PDB entry)
  8. 1906826Domain d1spbp_: 1spb P: [39068]
    Other proteins in same PDB: d1spbs_
    CASP1
    complexed with na; mutant

Details for d1spbp_

PDB Entry: 1spb (more details), 2 Å

PDB Description: subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c
PDB Compounds: (P:) subtilisin bpn' prosegment

SCOPe Domain Sequences for d1spbp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spbp_ d.58.3.2 (P:) Subtilisin prosegment {Bacillus amyloliquefaciens [TaxId: 1390]}
ekkyivgfkqtmstmsaakkkdvisekggkvqkqfkyvdaasatlnekavkelkkdpsva
yveedhvahay

SCOPe Domain Coordinates for d1spbp_:

Click to download the PDB-style file with coordinates for d1spbp_.
(The format of our PDB-style files is described here.)

Timeline for d1spbp_: