Lineage for d1spbp_ (1spb P:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32524Superfamily d.58.3: Protease propeptides [54897] (2 families) (S)
  5. 32537Family d.58.3.2: Subtilisin prosegment [54905] (1 protein)
  6. 32538Protein Subtilisin prosegment [54906] (2 species)
  7. 32539Species Bacillus amyloliquefaciens [TaxId:1390] [54907] (1 PDB entry)
  8. 32540Domain d1spbp_: 1spb P: [39068]
    Other proteins in same PDB: d1spbs_

Details for d1spbp_

PDB Entry: 1spb (more details), 2 Å

PDB Description: subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c

SCOP Domain Sequences for d1spbp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spbp_ d.58.3.2 (P:) Subtilisin prosegment {Bacillus amyloliquefaciens}
ekkyivgfkqtmstmsaakkkdvisekggkvqkqfkyvdaasatlnekavkelkkdpsva
yveedhvahay

SCOP Domain Coordinates for d1spbp_:

Click to download the PDB-style file with coordinates for d1spbp_.
(The format of our PDB-style files is described here.)

Timeline for d1spbp_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1spbs_