Lineage for d6ky3a2 (6ky3 A:96-357)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581287Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2581288Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2581421Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2581485Protein automated matches [226885] (7 species)
    not a true protein
  7. 2581489Species Daphnia magna [TaxId:35525] [390671] (2 PDB entries)
  8. 2581490Domain d6ky3a2: 6ky3 A:96-357 [390672]
    Other proteins in same PDB: d6ky3a1, d6ky3a3
    automated match to d5u92a2
    complexed with arg, k, po4; mutant

Details for d6ky3a2

PDB Entry: 6ky3 (more details), 1.34 Å

PDB Description: structure of arginine kinase h284a mutant
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d6ky3a2:

Sequence, based on SEQRES records: (download)

>d6ky3a2 d.128.1.2 (A:96-357) automated matches {Daphnia magna [TaxId: 35525]}
gdahpprdfgdletfgnldpegafivstrvrcgrslagyafnpclteanykemeekvvas
lsslegelkgtyypltgmtkevqtqliqdrflfkegdrflqaanacrywptgrgiyhnda
ktflvwcneedhlriismqkggdlkavyarlvnaineiekripfshhdkygfltfcptnl
gttirasvaialpklaadlakleeaagkfnlqvrgtagehteaeggvydisnkrrmglte
yqavkemydglqelirmekeaa

Sequence, based on observed residues (ATOM records): (download)

>d6ky3a2 d.128.1.2 (A:96-357) automated matches {Daphnia magna [TaxId: 35525]}
gdahpprdfgdletfgnldpegafivstrvrcgrslagyafnpclteanykemeekvvas
lsslegelkgtyypltgmtkevqtqliqdrflfkegdrflqaanacrywptgrgiyhnda
ktflvwcneedhlriismqkggdlkavyarlvnaineiekripfshhdkygfltfcptnl
gttirasvaialpklaadlakleeaagkfnlqvrgggvydisnkrrmglteyqavkemyd
glqelirmekeaa

SCOPe Domain Coordinates for d6ky3a2:

Click to download the PDB-style file with coordinates for d6ky3a2.
(The format of our PDB-style files is described here.)

Timeline for d6ky3a2: