![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
![]() | Protein automated matches [226884] (9 species) not a true protein |
![]() | Species Daphnia magna [TaxId:35525] [390669] (2 PDB entries) |
![]() | Domain d6ky3a1: 6ky3 A:1-95 [390670] Other proteins in same PDB: d6ky3a2, d6ky3a3 automated match to d5u92a1 complexed with arg, k, po4; mutant |
PDB Entry: 6ky3 (more details), 1.34 Å
SCOPe Domain Sequences for d6ky3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ky3a1 a.83.1.0 (A:1-95) automated matches {Daphnia magna [TaxId: 35525]} mvdaavaekleagfqklqeatncksllkkhltreifdkikdlktsfgstlldviqsgven ldsgfgvyapdaeaysvfndlfepmicdyhtgfkp
Timeline for d6ky3a1: