Lineage for d6ky3a1 (6ky3 A:1-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719300Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 2719301Protein automated matches [226884] (9 species)
    not a true protein
  7. 2719305Species Daphnia magna [TaxId:35525] [390669] (2 PDB entries)
  8. 2719306Domain d6ky3a1: 6ky3 A:1-95 [390670]
    Other proteins in same PDB: d6ky3a2, d6ky3a3
    automated match to d5u92a1
    complexed with arg, k, po4; mutant

Details for d6ky3a1

PDB Entry: 6ky3 (more details), 1.34 Å

PDB Description: structure of arginine kinase h284a mutant
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d6ky3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ky3a1 a.83.1.0 (A:1-95) automated matches {Daphnia magna [TaxId: 35525]}
mvdaavaekleagfqklqeatncksllkkhltreifdkikdlktsfgstlldviqsgven
ldsgfgvyapdaeaysvfndlfepmicdyhtgfkp

SCOPe Domain Coordinates for d6ky3a1:

Click to download the PDB-style file with coordinates for d6ky3a1.
(The format of our PDB-style files is described here.)

Timeline for d6ky3a1: