SCOPe 2.07: Domain d1pbaa_: 1pba A:

Lineage for d1pbaa_ (1pba A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families)

5. Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)

6. Protein Procarboxypeptidase B [54903] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [54904] (2 PDB entries)

8. Domain d1pbaa_: 1pba A: [39067]

Details for d1pbaa_

PDB Entry: 1pba

PDB Description: the nmr structure of the activation domain isolated from porcine procarboxypeptidase b

PDB Compounds: (A:) Procarboxypeptidase B

SCOPe Domain Sequences for d1pbaa_:

Sequence; same for both SEQRES and ATOM records:

>d1pbaa_ d.58.3.1 (A:) Procarboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
hhsgehfegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaed
ilavedfleqnelqyevlinn

Timeline for d1pbaa_:

• d1pbaa_ first appeared (with stable ids) in SCOP 1.55, called d1pba__
  
• d1pbaa_ appears in SCOPe 2.06
  
• d1pbaa_ appears in the current release, SCOPe 2.08