Lineage for d1pbaa_ (1pba A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906795Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 1906796Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)
  6. 1906809Protein Procarboxypeptidase B [54903] (2 species)
  7. 1906813Species Pig (Sus scrofa) [TaxId:9823] [54904] (2 PDB entries)
  8. 1906815Domain d1pbaa_: 1pba A: [39067]

Details for d1pbaa_

PDB Entry: 1pba (more details)

PDB Description: the nmr structure of the activation domain isolated from porcine procarboxypeptidase b
PDB Compounds: (A:) Procarboxypeptidase B

SCOPe Domain Sequences for d1pbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbaa_ d.58.3.1 (A:) Procarboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
hhsgehfegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaed
ilavedfleqnelqyevlinn

SCOPe Domain Coordinates for d1pbaa_:

Click to download the PDB-style file with coordinates for d1pbaa_.
(The format of our PDB-style files is described here.)

Timeline for d1pbaa_: