Lineage for d1pba__ (1pba -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192127Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families) (S)
  5. 192128Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)
  6. 192138Protein Procarboxypeptidase B [54903] (2 species)
  7. 192142Species Pig (Sus scrofa) [TaxId:9823] [54904] (2 PDB entries)
  8. 192144Domain d1pba__: 1pba - [39067]

Details for d1pba__

PDB Entry: 1pba (more details)

PDB Description: the nmr structure of the activation domain isolated from porcine procarboxypeptidase b

SCOP Domain Sequences for d1pba__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pba__ d.58.3.1 (-) Procarboxypeptidase B {Pig (Sus scrofa)}
hhsgehfegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaed
ilavedfleqnelqyevlinn

SCOP Domain Coordinates for d1pba__:

Click to download the PDB-style file with coordinates for d1pba__.
(The format of our PDB-style files is described here.)

Timeline for d1pba__: