SCOPe 2.08: Domain d6kvsb2: 6kvs B:489-626

Lineage for d6kvsb2 (6kvs B:489-626)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:418127] [390616] (1 PDB entry)

8. Domain d6kvsb2: 6kvs B:489-626 [390662]
   automated match to d3il7a2
   complexed with oax

Details for d6kvsb2

PDB Entry: 6kvs, 2.3 Å

PDB Description: staphylococcus aureus fabh with covalent inhibitor oxa1

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d6kvsb2:

Sequence; same for both SEQRES and ATOM records:

>d6kvsb2 c.95.1.0 (B:489-626) automated matches {Staphylococcus aureus [TaxId: 418127]}
isyemgsdgtggkhlyldkdtgklkmngrevfkfavrimgdastrvvekanltsddidlf
iphqanirimesarerlgiskdkmsvsvnkygntsaasiplsidqelkngklkdddtivl
vgfgggltwgamtikwgk

Timeline for d6kvsb2:

• d6kvsb2 first appeared in SCOPe 2.07