Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Staphylococcus aureus [TaxId:418127] [390616] (1 PDB entry) |
Domain d6kvsb1: 6kvs B:314-488 [390661] automated match to d3il7a1 complexed with oax |
PDB Entry: 6kvs (more details), 2.3 Å
SCOPe Domain Sequences for d6kvsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kvsb1 c.95.1.0 (B:314-488) automated matches {Staphylococcus aureus [TaxId: 418127]} mnvgikgfgayapekiidnayfeqfldtsdewiskmtgikerhwadddqdtsdlayeasv kaiadagiqpedidmiivatatgdmpfptvanmlqerlgtgkvasmdqlaacsgfmysmi takqyvqsgdyhnilvvgadklskitdltdrstavlfgdgagaviigevsegrgi
Timeline for d6kvsb1: