Lineage for d6kvsb1 (6kvs B:314-488)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525541Species Staphylococcus aureus [TaxId:418127] [390616] (1 PDB entry)
  8. 2525544Domain d6kvsb1: 6kvs B:314-488 [390661]
    automated match to d3il7a1
    complexed with oax

Details for d6kvsb1

PDB Entry: 6kvs (more details), 2.3 Å

PDB Description: staphylococcus aureus fabh with covalent inhibitor oxa1
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d6kvsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kvsb1 c.95.1.0 (B:314-488) automated matches {Staphylococcus aureus [TaxId: 418127]}
mnvgikgfgayapekiidnayfeqfldtsdewiskmtgikerhwadddqdtsdlayeasv
kaiadagiqpedidmiivatatgdmpfptvanmlqerlgtgkvasmdqlaacsgfmysmi
takqyvqsgdyhnilvvgadklskitdltdrstavlfgdgagaviigevsegrgi

SCOPe Domain Coordinates for d6kvsb1:

Click to download the PDB-style file with coordinates for d6kvsb1.
(The format of our PDB-style files is described here.)

Timeline for d6kvsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6kvsb2