![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) ![]() |
![]() | Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) |
![]() | Protein Procarboxypeptidase B [54903] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [54904] (2 PDB entries) |
![]() | Domain d1nsaa2: 1nsa A:7A-95A [39066] Other proteins in same PDB: d1nsaa1 complexed with ben, zn |
PDB Entry: 1nsa (more details), 2.3 Å
SCOPe Domain Sequences for d1nsaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsaa2 d.58.3.1 (A:7A-95A) Procarboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} fegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaedilaved fleqnelqyevlinnlrsvleaqfdsvsr
Timeline for d1nsaa2: