Lineage for d1ayea2 (1aye A:4A-99A)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) 
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) 
Protein Procarboxypeptidase A [54899] (4 species) Species Human (Homo sapiens) [TaxId:9606] [54902] (3 PDB entries)
procarboxypeptidase A2
Domain d1ayea2: 1aye A:4A-99A [39065]
Other proteins in same PDB: d1ayea1
complexed with zn
Details for d1ayea2
PDB Entry: 1aye (more details), 1.8 Å
PDB Description: human procarboxypeptidase a2
PDB Compounds: (A:) procarboxypeptidase a2SCOPe Domain Sequences for d1ayea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ayea2 d.58.3.1 (A:4A-99A) Procarboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
letfvgdqvleivpsneeqiknllqleaqehlqldfwkspttpgetahvrvpfvnvqavk
vflesqgiaysimiedvqvlldkeneemlfnrrr
SCOPe Domain Coordinates for d1ayea2:
Click to download the PDB-style file with coordinates for d1ayea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ayea2:
- d1ayea2 first appeared (with stable ids) in SCOP 1.55, called d1aye_2
- d1ayea2 appears in SCOPe 2.07
View in 3D
