Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza a virus [TaxId:1071165] [390643] (1 PDB entry) |
Domain d4kw1c_: 4kw1 C: [390648] Other proteins in same PDB: d4kw1b1, d4kw1b2, d4kw1d_, d4kw1f1, d4kw1f2, d4kw1h1, d4kw1h2 automated match to d4xkga_ complexed with nag, po4 |
PDB Entry: 4kw1 (more details), 2.5 Å
SCOPe Domain Sequences for d4kw1c_:
Sequence, based on SEQRES records: (download)
>d4kw1c_ b.19.1.0 (C:) automated matches {Influenza a virus [TaxId: 1071165]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsvagw llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks swsdheasgvssvcpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp ndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilksndainf esngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltige cpkyvksnrlvlatglrnsp
>d4kw1c_ b.19.1.0 (C:) automated matches {Influenza a virus [TaxId: 1071165]} dqicigyhannsteqvdtimeknvtvthaqdilekthngklcnldgvkplilrdcsvagw llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks swsdheasgvssvcsffrnvvwltkkdnayptikrsynntnqedllvlwgihhpndaaeq trlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilksndainfesngnf iapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltigecpkyvk snrlvlatglrnsp
Timeline for d4kw1c_: