Lineage for d6kyit_ (6kyi T:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564397Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2564398Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2564681Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2564682Protein automated matches [336552] (9 species)
    not a true protein
  7. 2564701Species Oryza sativa [TaxId:39947] [390640] (1 PDB entry)
  8. 2564703Domain d6kyit_: 6kyi T: [390641]
    Other proteins in same PDB: d6kyia1, d6kyia2, d6kyib1, d6kyib2
    automated match to d1uw9c_
    complexed with gol, so4

Details for d6kyit_

PDB Entry: 6kyi (more details), 1.75 Å

PDB Description: rice rubisco in complex with sulfate ions
PDB Compounds: (T:) Ribulose bisphosphate carboxylase small chain, chloroplastic

SCOPe Domain Sequences for d6kyit_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kyit_ d.73.1.0 (T:) automated matches {Oryza sativa [TaxId: 39947]}
mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy
ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp

SCOPe Domain Coordinates for d6kyit_:

Click to download the PDB-style file with coordinates for d6kyit_.
(The format of our PDB-style files is described here.)

Timeline for d6kyit_: