Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.0: automated matches [336551] (1 protein) not a true family |
Protein automated matches [336552] (9 species) not a true protein |
Species Oryza sativa [TaxId:39947] [390640] (1 PDB entry) |
Domain d6kyit_: 6kyi T: [390641] Other proteins in same PDB: d6kyia1, d6kyia2, d6kyib1, d6kyib2 automated match to d1uw9c_ complexed with gol, so4 |
PDB Entry: 6kyi (more details), 1.75 Å
SCOPe Domain Sequences for d6kyit_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kyit_ d.73.1.0 (T:) automated matches {Oryza sativa [TaxId: 39947]} mqvwpiegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyrenhrspgy ydgrywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdnvrqvqlisfiaykpp
Timeline for d6kyit_: