Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) |
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) |
Protein Procarboxypeptidase A [54899] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [54901] (1 PDB entry) |
Domain d1pyta_: 1pyt A: [39064] Other proteins in same PDB: d1pytb_, d1pytc_, d1pytd_ complexed with ca, zn |
PDB Entry: 1pyt (more details), 2.35 Å
SCOPe Domain Sequences for d1pyta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pyta_ d.58.3.1 (A:) Procarboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} kedfvghqvlritaadeaevqtvkeledlehlqldfwrgpgqpgspidvrvpfpslqavk vfleahgiryrimiedvqslldeeqeqmfasqsr
Timeline for d1pyta_: