Lineage for d1pyta_ (1pyt A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193180Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 2193181Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)
  6. 2193182Protein Procarboxypeptidase A [54899] (4 species)
  7. 2193185Species Cow (Bos taurus) [TaxId:9913] [54901] (1 PDB entry)
  8. 2193186Domain d1pyta_: 1pyt A: [39064]
    Other proteins in same PDB: d1pytb_, d1pytc_, d1pytd_
    complexed with ca, zn

Details for d1pyta_

PDB Entry: 1pyt (more details), 2.35 Å

PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
PDB Compounds: (A:) procarboxypeptidase a

SCOPe Domain Sequences for d1pyta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyta_ d.58.3.1 (A:) Procarboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
kedfvghqvlritaadeaevqtvkeledlehlqldfwrgpgqpgspidvrvpfpslqavk
vfleahgiryrimiedvqslldeeqeqmfasqsr

SCOPe Domain Coordinates for d1pyta_:

Click to download the PDB-style file with coordinates for d1pyta_.
(The format of our PDB-style files is described here.)

Timeline for d1pyta_: