SCOPe 2.04: Domain d1pyta_: 1pyt A:

Lineage for d1pyta_ (1pyt A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families)

5. Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)

6. Protein Procarboxypeptidase A [54899] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54901] (1 PDB entry)

8. Domain d1pyta_: 1pyt A: [39064]
   Other proteins in same PDB: d1pytb_, d1pytc_, d1pytd_
   complexed with ca, zn

Details for d1pyta_

PDB Entry: 1pyt, 2.35 Å

PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c

PDB Compounds: (A:) procarboxypeptidase a

SCOPe Domain Sequences for d1pyta_:

Sequence; same for both SEQRES and ATOM records:

>d1pyta_ d.58.3.1 (A:) Procarboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
kedfvghqvlritaadeaevqtvkeledlehlqldfwrgpgqpgspidvrvpfpslqavk
vfleahgiryrimiedvqslldeeqeqmfasqsr

Timeline for d1pyta_:

• d1pyta_ first appeared (with stable ids) in SCOP 1.55
  
• d1pyta_ appears in SCOPe 2.03
  
• d1pyta_ appears in SCOPe 2.05
  
• d1pyta_ appears in the current release, SCOPe 2.08