Lineage for d1pyta_ (1pyt A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.3: Protease propeptides [54897] (2 families) 
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) Protein Procarboxypeptidase A [54899] (3 species) 
Species Cow (Bos taurus) [TaxId:9913] [54901] (1 PDB entry) 
Domain d1pyta_: 1pyt A: [39064]
Other proteins in same PDB: d1pytb_, d1pytc_, d1pytd_
Details for d1pyta_
PDB Entry: 1pyt (more details), 2.35 Å
PDB Description: ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
SCOP Domain Sequences for d1pyta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pyta_ d.58.3.1 (A:) Procarboxypeptidase A {Cow (Bos taurus)}
kedfvghqvlritaadeaevqtvkeledlehlqldfwrgpgqpgspidvrvpfpslqavk
vfleahgiryrimiedvqslldeeqeqmfasqsr
SCOP Domain Coordinates for d1pyta_:
Click to download the PDB-style file with coordinates for d1pyta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pyta_:
- d1pyta_ appears in SCOP 1.57
- d1pyta_ appears in the current release, SCOPe 2.08
View in 3D
