Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Streptomyces ambofaciens [TaxId:278992] [389953] (3 PDB entries) |
Domain d6kxhb_: 6kxh B: [390633] automated match to d5k3ba_ complexed with dy9, mlt, na; mutant |
PDB Entry: 6kxh (more details), 1.78 Å
SCOPe Domain Sequences for d6kxhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kxhb_ c.69.1.0 (B:) automated matches {Streptomyces ambofaciens [TaxId: 278992]} pgpvpsdrelarslpggfrsrharvggvrlhyvsgghgeplllvpgwpqtwwayrkvmpq larryhviavdlrgmggsdkpaggydkktmaadlhalvrglghrqvnvaghdigsmvafa faanhpeatrkvalldtphpdqseyemrilcrpgtgttlwwwafnqlqalpeqlmhgrmr hvidwlyansladqslvgdldrdiyanaynspqavragtrwfqachqditdqagygkltm pvlgiggnftfedlrnkltaqatdvhmvrasksvhylpeeepdvvagalldffg
Timeline for d6kxhb_: