SCOPe 2.07: Domain d6kxhb_: 6kxh B:

Lineage for d6kxhb_ (6kxh B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Streptomyces ambofaciens [TaxId:278992] [389953] (3 PDB entries)

8. Domain d6kxhb_: 6kxh B: [390633]
   automated match to d5k3ba_
   complexed with dy9, mlt, na; mutant

Details for d6kxhb_

PDB Entry: 6kxh, 1.78 Å

PDB Description: alp1u_y247f mutant in complex with fluostatin c

PDB Compounds: (B:) Putative hydrolase

SCOPe Domain Sequences for d6kxhb_:

Sequence; same for both SEQRES and ATOM records:

>d6kxhb_ c.69.1.0 (B:) automated matches {Streptomyces ambofaciens [TaxId: 278992]}
pgpvpsdrelarslpggfrsrharvggvrlhyvsgghgeplllvpgwpqtwwayrkvmpq
larryhviavdlrgmggsdkpaggydkktmaadlhalvrglghrqvnvaghdigsmvafa
faanhpeatrkvalldtphpdqseyemrilcrpgtgttlwwwafnqlqalpeqlmhgrmr
hvidwlyansladqslvgdldrdiyanaynspqavragtrwfqachqditdqagygkltm
pvlgiggnftfedlrnkltaqatdvhmvrasksvhylpeeepdvvagalldffg

Timeline for d6kxhb_:

• d6kxhb_ is new in SCOPe 2.07-stable
  
• d6kxhb_ appears in the current release, SCOPe 2.08