Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) |
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) |
Protein Procarboxypeptidase A [54899] (4 species) |
Species Pig (Sus scrofa) [TaxId:9823] [54900] (1 PDB entry) |
Domain d1pcaa1: 1pca A:4A-99A [39063] Other proteins in same PDB: d1pcaa2 complexed with cit, val, zn |
PDB Entry: 1pca (more details), 2 Å
SCOPe Domain Sequences for d1pcaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pcaa1 d.58.3.1 (A:4A-99A) Procarboxypeptidase A {Pig (Sus scrofa) [TaxId: 9823]} kedfvghqvlrisvddeaqvqkvkeledlehlqldfwrgparpgfpidvrvpfpsiqavk vfleahgirytimiedvqllldeeqeqmfasqgr
Timeline for d1pcaa1: