SCOPe 2.05: Domain d1pcaa1: 1pca A:4A-99A

Lineage for d1pcaa1 (1pca A:4A-99A)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families)

5. Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)

6. Protein Procarboxypeptidase A [54899] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [54900] (1 PDB entry)

8. Domain d1pcaa1: 1pca A:4A-99A [39063]
   Other proteins in same PDB: d1pcaa2
   complexed with cit, val, zn

Details for d1pcaa1

PDB Entry: 1pca, 2 Å

PDB Description: three dimensional structure of porcine pancreatic procarboxypeptidase a. a comparison of the a and b zymogens and their determinants for inhibition and activation

PDB Compounds: (A:) procarboxypeptidase a pcpa

SCOPe Domain Sequences for d1pcaa1:

Sequence; same for both SEQRES and ATOM records:

>d1pcaa1 d.58.3.1 (A:4A-99A) Procarboxypeptidase A {Pig (Sus scrofa) [TaxId: 9823]}
kedfvghqvlrisvddeaqvqkvkeledlehlqldfwrgparpgfpidvrvpfpsiqavk
vfleahgirytimiedvqllldeeqeqmfasqgr

Timeline for d1pcaa1:

• d1pcaa1 first appeared (with stable ids) in SCOP 1.55, called d1pca_2
  
• d1pcaa1 appears in SCOPe 2.04
  
• d1pcaa1 appears in SCOPe 2.06
  
• d1pcaa1 appears in the current release, SCOPe 2.08