Lineage for d6krxa_ (6krx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875762Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2875763Protein automated matches [190475] (10 species)
    not a true protein
  7. 2875994Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [390532] (2 PDB entries)
  8. 2875996Domain d6krxa_: 6krx A: [390628]
    automated match to d2i1yb_
    complexed with flc, iod

Details for d6krxa_

PDB Entry: 6krx (more details), 1.7 Å

PDB Description: crystal structure of atptp1 at 1.7 angstrom
PDB Compounds: (A:) Protein-tyrosine-phosphatase PTP1

SCOPe Domain Sequences for d6krxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6krxa_ c.45.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lslssdqlnhchqalgvfrgkiqnpdsiaheftglqanrmwpselllnstvamnsvnvek
nrysdvvpfdknrivlnpckdssakgyvnasliktsesesisqfiatqgplphtmedfwe
mviqqhcpiivmltrlvdnnrtvkcgdyfqdedgprefgnislttkwikttdtslmlrnl
evnyketedqpmsvlhiqypewpdhgvpkdtvavreilkrlyqvppslgpiivhcsagig
rtgtycaihntiqrilagdmsaldlaktvalfrkqrigmvqtmdqyffcynaivdeledl
ta

SCOPe Domain Coordinates for d6krxa_:

Click to download the PDB-style file with coordinates for d6krxa_.
(The format of our PDB-style files is described here.)

Timeline for d6krxa_: