Lineage for d6kx2a_ (6kx2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867786Protein RhoA [52612] (1 species)
  7. 2867787Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
    Uniprot P61586 2-181
  8. 2867792Domain d6kx2a_: 6kx2 A: [390627]
    automated match to d4f38a_
    complexed with gdp

Details for d6kx2a_

PDB Entry: 6kx2 (more details), 1.45 Å

PDB Description: crystal structure of gdp bound rhoa protein
PDB Compounds: (A:) transforming protein rhoa

SCOPe Domain Sequences for d6kx2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kx2a_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
irkklvivgdgavgktsllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmvfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymetsaktkdgvrevfematraalq

SCOPe Domain Coordinates for d6kx2a_:

Click to download the PDB-style file with coordinates for d6kx2a_.
(The format of our PDB-style files is described here.)

Timeline for d6kx2a_: