SCOPe 2.05: Domain d2atcb1: 2atc B:1-100

Lineage for d2atcb1 (2atc B:1-100)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
   Uniprot P00478

8. Domain d2atcb1: 2atc B:1-100 [39062]
   Other proteins in same PDB: d2atca1, d2atca2, d2atcb2
   complexed with zn

Details for d2atcb1

PDB Entry: 2atc, 3 Å

PDB Description: crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli

PDB Compounds: (B:) aspartate carbamoyltransferase, regulatory chain

SCOPe Domain Sequences for d2atcb1:

Sequence; same for both SEQRES and ATOM records:

>d2atcb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthndklqvaeikrgtvinhipaeigfkllslfkltetqdritiglnlpsgemgrkdlik
ientflsedevdelalyapqatvnrindyevvgksrpslp

Timeline for d2atcb1:

• d2atcb1 first appeared (with stable ids) in SCOP 1.55
  
• d2atcb1 appears in SCOPe 2.04
  
• d2atcb1 appears in SCOPe 2.06
  
• d2atcb1 appears in the current release, SCOPe 2.08