Lineage for d2atcb1 (2atc B:1-100)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504113Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 504114Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 504115Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 504118Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)
  8. 504190Domain d2atcb1: 2atc B:1-100 [39062]
    Other proteins in same PDB: d2atca1, d2atca2, d2atcb2

Details for d2atcb1

PDB Entry: 2atc (more details), 3 Å

PDB Description: crystal and molecular structures of native and ctp-liganded aspartate carbamoyltransferase from escherichia coli

SCOP Domain Sequences for d2atcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2atcb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthndklqvaeikrgtvinhipaeigfkllslfkltetqdritiglnlpsgemgrkdlik
ientflsedevdelalyapqatvnrindyevvgksrpslp

SCOP Domain Coordinates for d2atcb1:

Click to download the PDB-style file with coordinates for d2atcb1.
(The format of our PDB-style files is described here.)

Timeline for d2atcb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2atcb2