Lineage for d1ezzd1 (1ezz D:1-100)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32472Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 32473Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 32474Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 32475Species Escherichia coli [TaxId:562] [54896] (25 PDB entries)
  8. 32522Domain d1ezzd1: 1ezz D:1-100 [39061]
    Other proteins in same PDB: d1ezza1, d1ezza2, d1ezzb2, d1ezzc1, d1ezzc2, d1ezzd2

Details for d1ezzd1

PDB Entry: 1ezz (more details), 2.7 Å

PDB Description: crystal structure of e. coli aspartate transcarbamoylase p268a mutant in the t-state

SCOP Domain Sequences for d1ezzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezzd1 d.58.2.1 (D:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1ezzd1:

Click to download the PDB-style file with coordinates for d1ezzd1.
(The format of our PDB-style files is described here.)

Timeline for d1ezzd1: