SCOPe 2.08: Domain d6kq1a_: 6kq1 A:

Lineage for d6kq1a_ (6kq1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (17 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:306] [390586] (1 PDB entry)

8. Domain d6kq1a_: 6kq1 A: [390587]
   automated match to d1cora_
   complexed with hec, zn

Details for d6kq1a_

PDB Entry: 6kq1, 1.57 Å

PDB Description: crystal structure of cytochrome c551 from pseudomonas sp. strain mt-1.

PDB Compounds: (A:) Cytochrome C biogenesis protein CcsA

SCOPe Domain Sequences for d6kq1a_:

Sequence; same for both SEQRES and ATOM records:

>d6kq1a_ a.3.1.1 (A:) automated matches {Pseudomonas sp. [TaxId: 306]}
qdgealfkskpcaachsidakmvgpalkevaakyagqegaadllaghikngtqgnwgpip
mppnpvteeeaktlaewvlslk

Timeline for d6kq1a_:

• d6kq1a_ first appeared in SCOPe 2.07