SCOPe 2.08: Domain d6kw1b_: 6kw1 B:

Lineage for d6kw1b_ (6kw1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries)

8. Domain d6kw1b_: 6kw1 B: [390576]
   automated match to d5lsca_
   complexed with 9rx, act, cl, fmt, mg, na, zn

Details for d6kw1b_

PDB Entry: 6kw1, 1.78 Å

PDB Description: the structure of the metallo-beta-lactamase vim-2 in complex with a triazolylthioacetamide 1b

PDB Compounds: (B:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d6kw1b_:

Sequence; same for both SEQRES and ATOM records:

>d6kw1b_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr

Timeline for d6kw1b_:

• d6kw1b_ first appeared in SCOPe 2.07