Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries) |
Domain d6kppb2: 6kpp B:244-429 [390568] Other proteins in same PDB: d6kppa1, d6kppb1, d6kppc1, d6kppd1, d6kppe_, d6kppf1, d6kppf2 automated match to d3rycd2 complexed with ca, do6, gdp, gol, gtp, mes, mg |
PDB Entry: 6kpp (more details), 2.75 Å
SCOPe Domain Sequences for d6kppb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kppb2 d.79.2.1 (B:244-429) automated matches {Pig (Sus scrofa) [TaxId: 9823]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdat
Timeline for d6kppb2: