Lineage for d6ku0c_ (6ku0 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727550Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2727551Family a.118.27.1: DIL domains from class V myosins [310651] (6 proteins)
  6. 2727582Protein automated matches [310888] (3 species)
    not a true protein
  7. 2727600Species Mouse (Mus musculus) [TaxId:10090] [390562] (1 PDB entry)
  8. 2727602Domain d6ku0c_: 6ku0 C: [390563]
    automated match to d5jczc_
    complexed with edo

Details for d6ku0c_

PDB Entry: 6ku0 (more details), 1.6 Å

PDB Description: crystal structure of myova-gtd in complex with mical1-gtbm
PDB Compounds: (C:) Unconventional myosin-Va

SCOPe Domain Sequences for d6ku0c_:

Sequence, based on SEQRES records: (download)

>d6ku0c_ a.118.27.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fqgmleykredeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetiqgvsgvkptglrkrtss
iadegtytldsilrqlnsfhsvmcqhgmdpelikqvvkqmfyivgaitlnnlllrkdmcs
wskgmqirynvsqleewlrdknlmnsgaketlepliqaaqllqvkkktdddaeaicsmcn
alttaqivkvlnlytpvnefeervsvsfirtiqmrlrdrkdspqllmdakhifpvtfpfn
psslaletiqipaslglgfiarv

Sequence, based on observed residues (ATOM records): (download)

>d6ku0c_ a.118.27.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fqgmleykredeqklvknlilelkprgvavnlipglpayilfmcvrhadylnddqkvrsl
ltstinsikkvlkkrgddfetvsfwlsntcrflhclkqysgeegfmkhntsrqnehcltn
fdlaeyrqvlsdlaiqiyqqlvrvlenilqpmivsgmlehetytldsilrqlnsfhsvmc
qhgmdpelikqvvkqmfyivgaitlnnlllrkdmcswskgmqirynvsqleewlrdknlm
nsgaketlepliqaaqllqvkkktdddaeaicsmcnalttaqivkvlnlytpvnefeerv
svsfirtiqmrlrdrkdspqllmdakhifpvtfpfnpsslaletiqipaslglgfiarv

SCOPe Domain Coordinates for d6ku0c_:

Click to download the PDB-style file with coordinates for d6ku0c_.
(The format of our PDB-style files is described here.)

Timeline for d6ku0c_: