SCOPe 2.08: Domain d6kppe_: 6kpp E:

Lineage for d6kppe_ (6kpp E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [390534] (14 PDB entries)

8. Domain d6kppe_: 6kpp E: [390535]
   Other proteins in same PDB: d6kppa1, d6kppa2, d6kppb1, d6kppb2, d6kppc1, d6kppc2, d6kppd1, d6kppd2, d6kppf1, d6kppf2
   automated match to d4i55e_
   complexed with ca, do6, gdp, gol, gtp, mes, mg

Details for d6kppe_

PDB Entry: 6kpp, 2.75 Å

PDB Description: bnc105 in complex with tubulin

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6kppe_:

Sequence, based on SEQRES records:

>d6kppe_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records):

>d6kppe_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

Timeline for d6kppe_:

• d6kppe_ first appeared in SCOPe 2.07