Lineage for d6krwa_ (6krw A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483040Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2483041Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2483697Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2483698Protein automated matches [190475] (10 species)
    not a true protein
  7. 2483699Species Arabidopsis thaliana [TaxId:3702] [390532] (2 PDB entries)
  8. 2483700Domain d6krwa_: 6krw A: [390533]
    automated match to d2qctb_
    complexed with flc, iod, peg

Details for d6krwa_

PDB Entry: 6krw (more details), 1.4 Å

PDB Description: crystal structure of atptp1 at 1.4 angstrom
PDB Compounds: (A:) Protein-tyrosine-phosphatase PTP1

SCOPe Domain Sequences for d6krwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6krwa_ c.45.1.0 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
sklslssdqlnhchqalgvfrgkiqnpdsiaheftglqanrmwpselllnstvamnsvnv
eknrysdvvpfdknrivlnpckdssakgyvnasliktsesesisqfiatqgplphtmedf
wemviqqhcpiivmltrlvdnnrtvkcgdyfqdedgprefgnislttkwikttdtslmlr
nlevnyketedqpmsvlhiqypewpdhgvpkdtvavreilkrlyqvppslgpiivhcsag
igrtgtycaihntiqrilagdmsaldlaktvalfrkqrigmvqtmdqyffcynaivdele
dltagt

SCOPe Domain Coordinates for d6krwa_:

Click to download the PDB-style file with coordinates for d6krwa_.
(The format of our PDB-style files is described here.)

Timeline for d6krwa_: