![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
![]() | Protein automated matches [190475] (10 species) not a true protein |
![]() | Species Arabidopsis thaliana [TaxId:3702] [390532] (2 PDB entries) |
![]() | Domain d6krwa_: 6krw A: [390533] automated match to d2qctb_ complexed with flc, iod, peg |
PDB Entry: 6krw (more details), 1.4 Å
SCOPe Domain Sequences for d6krwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6krwa_ c.45.1.0 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]} sklslssdqlnhchqalgvfrgkiqnpdsiaheftglqanrmwpselllnstvamnsvnv eknrysdvvpfdknrivlnpckdssakgyvnasliktsesesisqfiatqgplphtmedf wemviqqhcpiivmltrlvdnnrtvkcgdyfqdedgprefgnislttkwikttdtslmlr nlevnyketedqpmsvlhiqypewpdhgvpkdtvavreilkrlyqvppslgpiivhcsag igrtgtycaihntiqrilagdmsaldlaktvalfrkqrigmvqtmdqyffcynaivdele dltagt
Timeline for d6krwa_: