Lineage for d7at1b1 (7at1 B:8-100)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412028Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 412029Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 412030Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 412031Species Escherichia coli [TaxId:562] [54896] (27 PDB entries)
  8. 412072Domain d7at1b1: 7at1 B:8-100 [39053]
    Other proteins in same PDB: d7at1a1, d7at1a2, d7at1b2, d7at1c1, d7at1c2, d7at1d2

Details for d7at1b1

PDB Entry: 7at1 (more details), 2.8 Å

PDB Description: crystal structures of aspartate carbamoyltransferase ligated with phosphonoacetamide, malonate, and ctp or atp at 2.8-angstroms resolution and neutral p*h

SCOP Domain Sequences for d7at1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d7at1b1:

Click to download the PDB-style file with coordinates for d7at1b1.
(The format of our PDB-style files is described here.)

Timeline for d7at1b1: