Lineage for d7at1b1 (7at1 B:8-100)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) 
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) Protein Aspartate carbamoyltransferase [54895] (1 species) Species Escherichia coli [TaxId:562] [54896] (26 PDB entries) 
Domain d7at1b1: 7at1 B:8-100 [39053]
Other proteins in same PDB: d7at1a1, d7at1a2, d7at1b2, d7at1c1, d7at1c2, d7at1d2
Details for d7at1b1
PDB Entry: 7at1 (more details), 2.8 Å
PDB Description: crystal structures of aspartate carbamoyltransferase ligated with phosphonoacetamide, malonate, and ctp or atp at 2.8-angstroms resolution and neutral p*h
SCOP Domain Sequences for d7at1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp
SCOP Domain Coordinates for d7at1b1:
Click to download the PDB-style file with coordinates for d7at1b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7at1b1:
View in 3D
